PDB entry 1aob

View 1aob on RCSB PDB site
Description: e. coli thymidylate synthase complexed with ddurd
Class: methyltransferase
Keywords: transferase (methyltransferase), substrate modules
Deposited on 1997-06-30, released 1998-07-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.193
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidylate synthase
    Species: Escherichia coli [TaxId:562]
    Gene: thyA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1aoba_
  • Heterogens: PO4, DDU, FMT

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aobA (A:)
    mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
    wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
    ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
    yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
    dyrfedfeiegydphpgikapvai