PDB entry 1aoa

View 1aoa on RCSB PDB site
Description: n-terminal actin-crosslinking domain from human fimbrin
Class: actin-binding protein
Keywords: actin-binding protein, calcium-binding, phosphorylation
Deposited on 1997-06-30, released 1997-12-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.186
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: t-fimbrin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aoaa1, d1aoaa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aoaA (A:)
    egicalggtselssegtqhsyseeekyafvnwinkalendpdcrhvipmnpntddlfkav
    gdgivlckminlsvpdtiderainkkkltpfiiqenlnlalnsasaigchvvnigaedlr
    agkphlvlgllwqiikiglfadielsrnealaallrdgetleelmklspeelllrwanfh
    lensgwqkinnfsadikdskayfhllnqiapkgqkegepridinmsgfnetddlkraesm
    lqqadklgcrqfvtpadvvsgnpklnlafvanlfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aoaA (A:)
    yseeekyafvnwinkalendpdcrhvipmnpntddlfkavgdgivlckminlsvpdtide
    rainkkkltpfiiqenlnlalnsasaigchvvnigaedlragkphlvlgllwqiikiglf
    adielsrnealtleelmklspeelllrwanfhlensgwqkinnfsadikdskayfhllnq
    iapkgqkegepridinmsgfnetddlkraesmlqqadklgcrqfvtpadvvsgnpklnla
    fvanlfn