PDB entry 1ao5

View 1ao5 on RCSB PDB site
Description: mouse glandular kallikrein-13 (prorenin converting enzyme)
Class: serine protease
Keywords: glandular kallikrein, serine protease, protein maturation
Deposited on 1997-07-16, released 1997-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.197
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glandular kallikrein-13
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36368 (0-236)
      • conflict (7)
      • conflict (94)
    Domains in SCOPe 2.07: d1ao5a_
  • Chain 'B':
    Compound: glandular kallikrein-13
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36368 (0-236)
      • conflict (7)
      • conflict (94)
    Domains in SCOPe 2.07: d1ao5b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ao5A (A:)
    vvggfnceknsqpwqvavyyqkehicggvlldrnwvltaahcyvdqyevwlgknklfqee
    psaqhrlvsksfphpgfnmsllmlqtippgadfsddlmllrlskpaditdvvkpialptk
    epkpgskclasgwgsitptrwqkpddlqcvfitllpnencakvylqkvtdvmlcagemgg
    gkdtcrddsggplicdgilqgttsygpvpcgkpgvpaiytnlikfnswikdtmmkna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ao5A (A:)
    vvggfnceknsqpwqvavyyqkehicggvlldrnwvltaahcyvdqyevwlgknklfqee
    psaqhrlvsksfphpgfnmsllmlqtippgadfsddlmllrlskpaditdvvkpialptk
    epkpgskclasgwgsitptwqkpddlqcvfitllpnencakvylqkvtdvmlcagemggg
    kdtcrddsggplicdgilqgttsygpvpcgkpgvpaiytnlikfnswikdtmmkna
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ao5B (B:)
    vvggfnceknsqpwqvavyyqkehicggvlldrnwvltaahcyvdqyevwlgknklfqee
    psaqhrlvsksfphpgfnmsllmlqtippgadfsddlmllrlskpaditdvvkpialptk
    epkpgskclasgwgsitptrwqkpddlqcvfitllpnencakvylqkvtdvmlcagemgg
    gkdtcrddsggplicdgilqgttsygpvpcgkpgvpaiytnlikfnswikdtmmkna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ao5B (B:)
    vvggfnceknsqpwqvavyyqkehicggvlldrnwvltaahcyvdqyevwlgknklfqee
    psaqhrlvsksfphpgfnmsllmlqtippgadfsddlmllrlskpaditdvvkpialptk
    epkpgskclasgwgsitptwqkpddlqcvfitllpnencakvylqkvtdvmlcagemggg
    kdtcrddsggplicdgilqgttsygpvpcgkpgvpaiytnlikfnswikdtmmkna