PDB entry 1anx

View 1anx on RCSB PDB site
Description: the crystal structure of a new high-calcium form of annexin v
Deposited on 1993-10-26, released 1994-12-20
The last revision prior to the SCOP 1.57 freeze date was dated 1994-12-20, with a file datestamp of 1995-01-05.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.198
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1anxa_
  • Chain 'B':
    Domains in SCOP 1.57: d1anxb_
  • Chain 'C':
    Domains in SCOP 1.57: d1anxc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1anxA (A:)
    qvlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfg
    rdllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpeel
    raikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfqa
    gelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvk
    sirsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikg
    dtsgdykkallllcge
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1anxB (B:)
    qvlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfg
    rdllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpeel
    raikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfqa
    gelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvk
    sirsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikg
    dtsgdykkallllcge
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1anxC (C:)
    qvlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfg
    rdllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpeel
    raikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfqa
    gelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvk
    sirsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikg
    dtsgdykkallllcge