PDB entry 1anx

View 1anx on RCSB PDB site
Description: the crystal structure of a new high-calcium form of annexin v
Class: calcium/phospholipid-binding protein
Keywords: calcium/phospholipid-binding protein
Deposited on 1993-10-26, released 1994-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.198
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: annexin v
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1anxa_
  • Chain 'B':
    Compound: annexin v
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1anxb_
  • Chain 'C':
    Compound: annexin v
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1anxc_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1anxA (A:)
    aqvlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlf
    grdllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpee
    lraikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfq
    agelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavv
    ksirsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmik
    gdtsgdykkallllcgedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1anxA (A:)
    qvlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfg
    rdllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpeel
    raikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfqa
    gelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvk
    sirsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikg
    dtsgdykkallllcge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1anxB (B:)
    aqvlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlf
    grdllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpee
    lraikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfq
    agelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavv
    ksirsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmik
    gdtsgdykkallllcgedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1anxB (B:)
    qvlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfg
    rdllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpeel
    raikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfqa
    gelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvk
    sirsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikg
    dtsgdykkallllcge
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1anxC (C:)
    aqvlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlf
    grdllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpee
    lraikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfq
    agelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavv
    ksirsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmik
    gdtsgdykkallllcgedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1anxC (C:)
    qvlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfg
    rdllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpeel
    raikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfqa
    gelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvk
    sirsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikg
    dtsgdykkallllcge