PDB entry 1anw

View 1anw on RCSB PDB site
Description: the effect of metal binding on the structure of annexin v and implications for membrane binding
Deposited on 1993-10-26, released 1994-12-20
The last revision prior to the SCOP 1.57 freeze date was dated 1994-12-20, with a file datestamp of 1995-01-05.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.181
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1anwa_
  • Chain 'B':
    Domains in SCOP 1.57: d1anwb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1anwA (A:)
    aqvlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlf
    grdllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpee
    lraikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfq
    agelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavv
    ksirsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmik
    gdtsgdykkallllcgedd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1anwB (B:)
    aqvlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlf
    grdllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpee
    lraikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfq
    agelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavv
    ksirsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmik
    gdtsgdykkallllcgedd