PDB entry 1anw

View 1anw on RCSB PDB site
Description: the effect of metal binding on the structure of annexin v and implications for membrane binding
Class: calcium/phospholipid-binding protein
Keywords: calcium/phospholipid-binding protein
Deposited on 1993-10-26, released 1994-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.181
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: annexin v
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1anwa_
  • Chain 'B':
    Compound: annexin v
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1anwb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1anwA (A:)
    aqvlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlf
    grdllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpee
    lraikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfq
    agelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavv
    ksirsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmik
    gdtsgdykkallllcgedd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1anwB (B:)
    aqvlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlf
    grdllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpee
    lraikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfq
    agelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavv
    ksirsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmik
    gdtsgdykkallllcgedd