PDB entry 1anv

View 1anv on RCSB PDB site
Description: adenovirus 5 dbp/uranyl fluoride soak
Class: DNA-binding protein
Keywords: early protein, DNA-binding protein, zinc-finger, phosphorylation, nuclear protein
Deposited on 1996-03-14, released 1997-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.204
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenovirus single-stranded DNA-binding protein
    Species: Human adenovirus 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1anva1, d1anva2, d1anva3
  • Heterogens: ZN, IUM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1anvA (A:)
    svpivsawekgmeaaralmdkyhvdndlkanfkllpdqvealaavcktwlneehrglqlt
    ftsnktfvtmmgrflqaylqsfaevtykhheptgcalwlhrcaeiegelkclhgsimink
    ehviemdvtsengqralkeqsskakivknrwgrnvvqisntdarccvhdaacpanqfsgk
    scgmffsegakaqvafkqikafmqalypnaqtghghllmplrcecnskpghapflgrqlp
    kltpfalsnaedldadlisdksvlasvhhpalivfqccnpvyrnsraqgggpncdfkisa
    pdllnalvmvrslwsenftelprmvvpefkwstkhqyrnvslpvahsdarqnpfdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1anvA (A:)
    sawekgmeaaralmdkyhvdndlkanfkllpdqvealaavcktwlneehrglqltftsnk
    tfvtmmgrflqaylqsfaevtykhheptgcalwlhrcaeiegelkclhgsiminkehvie
    nvvqisntdarccvhdaacpanqfsgkscgmffsegakaqvafkqikafmqalypnaqtg
    hghllmplrcecnskpghapflgrqlpkltpfalsnaedldadlisdksvlasvhhpali
    vfqccnpggpncdfkisapdllnalvmvrslwsenftelprmvvpefkwstkhqyrnvsl
    pvahsdarqnpfdf