PDB entry 1anu

View 1anu on RCSB PDB site
Description: cohesin-2 domain of the cellulosome from clostridium thermocellum
Class: cohesin
Keywords: cohesin, scaffolding, cellulose digestion, beta sandwich, thermophile
Deposited on 1996-07-19, released 1997-07-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.197
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cohesin-2
  Species: Clostridium thermocellum [TaxId:1515]
  Gene: CIPA (CIPB)
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q06851 (0-137)
  Domains in SCOPe 2.03: d1anua_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1anuA (A:)
  vvveigkvtgsvgttveipvyfrgvpskgiancdfvfrydpnvleiigidpgdiivdpnp
  tksfdtaiypdrkiivflfaedsgtgayaitkdgvfakiratvkssapgyitfdevggfa
  dndlveqkvsfidggvnv