PDB entry 1anu

View 1anu on RCSB PDB site
Description: cohesin-2 domain of the cellulosome from clostridium thermocellum
Class: cohesin
Keywords: cohesin, scaffolding, cellulose digestion, beta sandwich, thermophile
Deposited on 1996-07-19, released 1997-07-23
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.197
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cohesin-2
    Species: Clostridium thermocellum [TaxId:1515]
    Gene: CIPA (CIPB)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1anua_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1anuA (A:)
    vvveigkvtgsvgttveipvyfrgvpskgiancdfvfrydpnvleiigidpgdiivdpnp
    tksfdtaiypdrkiivflfaedsgtgayaitkdgvfakiratvkssapgyitfdevggfa
    dndlveqkvsfidggvnv