PDB entry 1anu

View 1anu on RCSB PDB site
Description: cohesin-2 domain of the cellulosome from clostridium thermocellum
Deposited on 1996-07-19, released 1997-07-23
The last revision prior to the SCOP 1.67 freeze date was dated 1997-07-23, with a file datestamp of 1997-07-24.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.197
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1anu__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1anu_ (-)
vvveigkvtgsvgttveipvyfrgvpskgiancdfvfrydpnvleiigidpgdiivdpnp
tksfdtaiypdrkiivflfaedsgtgayaitkdgvfakiratvkssapgyitfdevggfa
dndlveqkvsfidggvnv