PDB entry 1ann

View 1ann on RCSB PDB site
Description: annexin IV
Class: calcium/phospholipid-binding protein
Keywords: 32.5kd calelectrin, endonexin I, lipocortin IV, chromobindin IV, protein II, calcium-phospholipid-binding protein complex
Deposited on 1995-09-21, released 1996-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-12, with a file datestamp of 2013-06-07.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.249
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: annexin IV
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1anna_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1annA (A:)
    aakggtvkaasgfnaaedaqtlrkamkglgtdedaiinvlayrstaqrqeirtaykttig
    rdlmddlkselsgnfeqvilgmmtptvlydvqelrkamkgagtdegclieilasrtpeei
    rrinqtyqlqygrsleddirsdtsfmfqrvlvslsaggrdesnylddalmrqdaqdlyea
    gekkwgtdevkfltvlcsrnrnhllhvfdeykriaqkdieqsiksetsgsfedallaivk
    cmrnksayfaerlyksmkglgtdddtlirvmvsraeidmldiranfkrlygkslysfikg
    dtsgdyrkvllilcggdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1annA (A:)
    ggtvkaasgfnaaedaqtlrkamkglgtdedaiinvlayrstaqrqeirtaykttigrdl
    mddlkselsgnfeqvilgmmtptvlydvqelrkamkgagtdegclieilasrtpeeirri
    nqtyqlqygrsleddirsdtsfmfqrvlvslsaggrdesnylddalmrqdaqdlyeagek
    kwgtdevkfltvlcsrnrnhllhvfdeykriaqkdieqsiksetsgsfedallaivkcmr
    nksayfaerlyksmkglgtdddtlirvmvsraeidmldiranfkrlygkslysfikgdts
    gdyrkvllilcggdd