PDB entry 1anh

View 1anh on RCSB PDB site
Description: conversion of a magnesium binding site into a zinc binding site by a single amino acid substitution in escherichia coli alkaline phosphatase
Deposited on 1994-10-19, released 1995-01-26
The last revision was dated 1995-01-26, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.192
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    no info in PDB for this chain
  • Chain 'B':
    no info in PDB for this chain
  • Heterogens: ZN, PO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1anhA (A:)
    tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
    arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngal
    gvdihekdhptilemakaaglatgnvstaelqhatpaalvahvtsrkcygpsatsekcpg
    nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsda
    aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
    qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
    ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
    aygphaanvvgltdqtdlfytmkaalglk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1anhB (B:)
    tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
    arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngal
    gvdihekdhptilemakaaglatgnvstaelqhatpaalvahvtsrkcygpsatsekcpg
    nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsda
    aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
    qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
    ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
    aygphaanvvgltdqtdlfytmkaalglk