PDB entry 1anf

View 1anf on RCSB PDB site
Description: maltodextrin binding protein with bound maltose
Class: periplasmic binding protein
Keywords: periplasmic binding protein, sugar transport
Deposited on 1997-06-25, released 1997-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.182
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maltodextrin-binding protein
    Species: Escherichia coli [TaxId:83333]
    Gene: malE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1anfa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1anfA (A:)
    kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
    fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
    llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
    vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
    nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
    avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
    lkdaqtritk