PDB entry 1ane

View 1ane on RCSB PDB site
Description: anionic trypsin wild type
Class: serine protease
Keywords: trypsin, anionic, serine protease, hydrolase
Deposited on 1994-12-21, released 1997-04-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.175
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anionic trypsin
    Species: Rattus rattus [TaxId:10117]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1anea_
  • Heterogens: BEN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aneA (A:)
    ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
    neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
    wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
    vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan