PDB entry 1anc

View 1anc on RCSB PDB site
Description: anionic trypsin mutant with ser 214 replaced by lys
Deposited on 1994-12-21, released 1997-04-01
The last revision prior to the SCOP 1.59 freeze date was dated 1997-04-01, with a file datestamp of 1997-04-02.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.154
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1anc__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1anc_ (-)
    ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
    neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
    wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
    vvcngelqgivkwgygcalpdnpgvytkvcnyvdwiqdtiaan