PDB entry 1anb

View 1anb on RCSB PDB site
Description: anionic trypsin mutant with ser 214 replaced by glu
Class: serine protease
Keywords: trypsin, anionic, serine protease, hydrolase
Deposited on 1994-12-21, released 1997-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.167
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anionic trypsin
    Species: Rattus rattus [TaxId:10117]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00763 (0-222)
      • engineered (191)
    Domains in SCOPe 2.08: d1anba_
  • Heterogens: CA, BEN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1anbA (A:)
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivewgygcalpdnpgvytkvcnyvdwiqdtiaan