PDB entry 1an9

View 1an9 on RCSB PDB site
Description: d-amino acid oxidase complex with o-aminobenzoate
Class: oxidoreductase
Keywords: fad, oxidase, d-amino acid, oxidoreductase, flavoprotein
Deposited on 1997-06-28, released 1997-11-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.201
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-amino acid oxidase
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1an9a1, d1an9a2
  • Chain 'B':
    Compound: d-amino acid oxidase
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1an9b1, d1an9b2
  • Heterogens: FAD, BE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1an9A (A:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1an9B (B:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernll