PDB entry 1an7

View 1an7 on RCSB PDB site
Description: ribosomal protein s8 from thermus thermophilus
Class: ribosomal protein
Keywords: ribosomal protein, rRNA-protein binding, protein-protein binding, thermus thermophilus
Deposited on 1997-06-27, released 1998-07-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.162
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal protein s8
    Species: Thermus thermophilus [TaxId:274]
    Gene: RPS8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1an7a_
  • Chain 'B':
    Compound: ribosomal protein s8
    Species: Thermus thermophilus [TaxId:274]
    Gene: RPS8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1an7b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1an7A (A:)
    tdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylrvy
    lkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvltdr
    earklgvggelicevw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1an7B (B:)
    tdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylrvy
    lkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvltdr
    earklgvggelicevw