PDB entry 1an2

View 1an2 on RCSB PDB site
Description: recognition by max of its cognate DNA through a dimeric b/hlh/z domain
Class: transcription/DNA
Keywords: protein-DNA complex, double helix, transcription-DNA complex
Deposited on 1996-09-06, released 1996-04-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (transcription factor max (tf max))
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61244 (0-85)
  Domains in SCOPe 2.08: d1an2a_
• Chain 'B':
  Compound: DNA (5'-d(*gp*tp*gp*tp*ap*gp*gp*tp*cp*ap*cp*gp*tp*gp*ap*cp*c p*tp*ap*cp*ap*c)- 3')
  Species: Mus musculus [TaxId:10090]
  

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1an2A (A:)
  adkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhth
  qqdiddlkrqnalleqqvralekars
  

  
  
• Chain 'B':
  No sequence available.