PDB entry 1an2

View 1an2 on RCSB PDB site
Description: recognition by max of its cognate DNA through a dimeric b/hlh/z domain
Class: transcription/DNA
Keywords: protein-DNA complex, double helix, transcription-DNA complex
Deposited on 1996-09-06, released 1996-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-03, with a file datestamp of 2013-03-29.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.232
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (transcription factor max (tf max))
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1an2a_
  • Chain 'B':
    Compound: DNA (5'-d(*gp*tp*gp*tp*ap*gp*gp*tp*cp*ap*cp*gp*tp*gp*ap*cp*c p*tp*ap*cp*ap*c)- 3')
    Species: Mus musculus [TaxId:10090]

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1an2A (A:)
    adkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhth
    qqdiddlkrqnalleqqvralekars
    

  • Chain 'B':
    No sequence available.