PDB entry 1an1

View 1an1 on RCSB PDB site
Description: leech-derived tryptase inhibitor/trypsin complex
Class: complex (serine protease/inhibitor)
Keywords: serine proteinase inhibitor, tryptase inhibition, non-classical kazal-type inhibitor, complex (serine protease/inhibitor)
Deposited on 1997-06-26, released 1998-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.17
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Trypsin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00761 (0-222)
      • modified residue (96)
    Domains in SCOPe 2.07: d1an1e_
  • Chain 'I':
    Compound: tryptase inhibitor
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1an1i_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1an1E (E:)
    ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg
    neqfinaakiithpnfngntldndimliklsspatldsrvatvslprscaaagteclisg
    wgntkssgssypsllqclkapvlsdssckssypgqitgnmicvgfleggkdscqgdsggp
    vvcngqlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1an1I (I:)
    kkvcacpkilkpvcgsdgrtyansciarcngvsiksegscptgiln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1an1I (I:)
    kvcacpkilkpvcgsdgrtyansciarcngvsiksegscp