PDB entry 1an1

View 1an1 on RCSB PDB site
Description: leech-derived tryptase inhibitor/trypsin complex
Deposited on 1997-06-26, released 1998-07-01
The last revision prior to the SCOP 1.55 freeze date was dated 1998-07-01, with a file datestamp of 1998-07-01.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.17
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Domains in SCOP 1.55: d1an1e_
  • Chain 'I':
    Domains in SCOP 1.55: d1an1i_

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1an1E (E:)
    ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg
    neqfinaakiithpnfngntldndimliklsspatldsrvatvslprscaaagteclisg
    wgntkssgssypsllqclkapvlsdssckssypgqitgnmicvgfleggkdscqgdsggp
    vvcngqlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1an1I (I:)
    kvcacpkilkpvcgsdgrtyansciarcngvsiksegscp