PDB entry 1an0

View 1an0 on RCSB PDB site
Description: cdc42hs-GDP complex
Class: gtpase
Keywords: gtpase, g-protein, lipoprotein, prenylation
Deposited on 1997-06-26, released 1999-01-13
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.228
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cdc42hs-GDP
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60953 (1-End)
      • engineered (44)
    Domains in SCOPe 2.01: d1an0a_
  • Chain 'B':
    Compound: cdc42hs-GDP
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60953 (1-End)
      • engineered (44)
    Domains in SCOPe 2.01: d1an0b_
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1an0A (A:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
    epkksrrcvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1an0A (A:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
    epkksrrcv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1an0B (B:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
    epkksrrcvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1an0B (B:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaaleep
    kksrrcv