PDB entry 1amy

View 1amy on RCSB PDB site
Description: crystal and molecular structure of barley alpha-amylase
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1994-03-10, released 1995-05-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.153
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,4-alpha-d-glucan glucanohydrolase
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1amya1, d1amya2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1amyA (A:)
    qvlfqgfnweswkhnggwynflmgkvddiaaagithvwlppasqsvaeqgympgrlydld
    askygnkaqlksligalhgkgvkaiadivinhrtaehkdgrgiycifeggtpdarldwgp
    hmicrddrpyadgtgnpdtgadfgaapdidhlnlrvqkelvewlnwlkadigfdgwrfdf
    akgysadvakiyidrsepsfavaeiwtslayggdgkpnlnqdqhrqelvnwvdkvggkgp
    attfdfttkgilnvavegelwrlrgtdgkapgmigwwpakavtfvdnhdtgstqhmwpfp
    sdrvmqgyayilthpgtpcifydhffdwglkeeidrlvsvrtrhgihnesklqiieadad
    lylaeidgkvivklgprydvgnlipggfkvaahgndyavweki