PDB entry 1amx

View 1amx on RCSB PDB site
Description: collagen-binding domain from a staphylococcus aureus adhesin
Deposited on 1997-06-19, released 1998-06-24
The last revision prior to the SCOP 1.57 freeze date was dated 1998-06-24, with a file datestamp of 1998-06-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1amx__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1amx_ (-)
tssvfyyktgdmlpedtthvrwflninneksyvskditikdqiqggqqldlstlninvtg
thsnyysgqsaitdfekafpgskitvdntkntidvtipqgygsynsfsinyktkitneqq
kefvnnsqawyqehgkeevngksfnhtvhn