PDB entry 1amx

View 1amx on RCSB PDB site
Description: collagen-binding domain from a staphylococcus aureus adhesin
Class: bacterial adhesin
Keywords: bacterial adhesin, mscramm
Deposited on 1997-06-19, released 1998-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: collagen adhesin
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: CNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1amxa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1amxA (A:)
    mrgshhhhhhgsitsgnkstnvtvhkseagtssvfyyktgdmlpedtthvrwflninnek
    syvskditikdqiqggqqldlstlninvtgthsnyysgqsaitdfekafpgskitvdntk
    ntidvtipqgygsynsfsinyktkitneqqkefvnnsqawyqehgkeevngksfnhtvhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1amxA (A:)
    tssvfyyktgdmlpedtthvrwflninneksyvskditikdqiqggqqldlstlninvtg
    thsnyysgqsaitdfekafpgskitvdntkntidvtipqgygsynsfsinyktkitneqq
    kefvnnsqawyqehgkeevngksfnhtvhn