PDB entry 1amm

View 1amm on RCSB PDB site
Description: 1.2 angstrom structure of gamma-b crystallin at 150k
Deposited on 1996-03-20, released 1996-11-08
The last revision prior to the SCOP 1.69 freeze date was dated 1996-11-08, with a file datestamp of 1996-11-08.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.185
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1amm_ (-)
gkitfyedrgfqghcyecssdcpnlqpyfsrcnsirvdsgcwmlyerpnyqghqyflrrg
dypdyqqwmgfndsirscrlipqhtgtfrmriyerddfrgqmseitddcpslqdrfhlte
vhslnvlegswvlyempsyrgrqyllrpgeyrryldwgamnakvgslrrvmdfy