PDB entry 1aml

View 1aml on RCSB PDB site
Description: the alzheimer`s disease amyloid a4 peptide (residues 1-40)
Class: serine protease inhibitor
Keywords: serine protease inhibitor
Deposited on 1995-02-13, released 1996-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: amyloid a4
  Species: Homo sapiens [TaxId:9606]
  Gene: POTENTIAL
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05067 (0-39)
  Domains in SCOPe 2.08: d1amla_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1amlA (A:)
  daefrhdsgyevhhqklvffaedvgsnkgaiiglmvggvv