PDB entry 1amk

View 1amk on RCSB PDB site
Description: leishmania mexicana triose phosphate isomerase
Class: gluconeogenesis
Keywords: tim, 2-pg, pga, gluconeogenesis, fatty acid biosynthesis
Deposited on 1997-06-17, released 1997-12-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.107
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triose phosphate isomerase
    Species: Leishmania mexicana [TaxId:5665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1amka_
  • Heterogens: PGA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1amkA (A:)
    msakpqpiaaanwkcngttasieklvqvfnehtishdvqcvvaptfvhiplvqaklrnpk
    yvisaenaiaksgaftgevsmpilkdigvhwvilghserrtyygetdeivaqkvseackq
    gfmviacigetlqqreanqtakvvlsqtsaiaakltkdawnqvvlayepvwaigtgkvat
    peqaqevhlllrkwvsenigtdvaaklrilyggsvnaanaatlyakpdingflvggaslk
    pefrdiidatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1amkA (A:)
    sakpqpiaaanwkcngttasieklvqvfnehtishdvqcvvaptfvhiplvqaklrnpky
    visaenaiaksgaftgevsmpilkdigvhwvilghserrtyygetdeivaqkvseackqg
    fmviacigetlqqreanqtakvvlsqtsaiaakltkdawnqvvlayepvwaigtgkvatp
    eqaqevhlllrkwvsenigtdvaaklrilyggsvnaanaatlyakpdingflvggaslkp
    efrdiidatr