PDB entry 1amj

View 1amj on RCSB PDB site
Description: steric and conformational features of the aconitase mechanism
Class: lyase(carbon-oxygen)
Keywords: lyase(carbon-oxygen)
Deposited on 1994-11-11, released 1995-01-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aconitase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20004 (Start-753)
      • conflict (12)
      • conflict (25)
      • conflict (71)
      • conflict (189)
      • conflict (381)
      • conflict (407)
      • conflict (527)
      • conflict (549)
      • conflict (596)
      • conflict (599)
      • conflict (624)
      • conflict (646)
      • conflict (652)
      • conflict (699)
      • insertion (751)
    Domains in SCOPe 2.07: d1amja1, d1amja2
  • Heterogens: OH, SO4, SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1amjA (A:)
    qrakvamshfepheyirydlleknidivrkrlnrpltlsekivyghlddpanqeiergkt
    ylrlrpdrvamqdataqmamlqfissglpkvavpstihcdhlieaqlggekdlrrakdin
    qevynflatagakygvgfwrpgsgiihqiilenyaypgvlligtdshtpnggglggicig
    vggadavdvmagipwelkcpkvigvkltgslsgwtspkdvilkvagiltvkggtgaivey
    hgpgvdsisctgmaticnmgaeigattsvfpynhrmkkylsktgradianladefkdhlv
    pdsgchydqlieinlselkphingpftpdlahpvaevgsvaekegwpldirvgligsctn
    ssyedmgrsaavakqalahglkcksqftitpgseqiratierdgyaqvlrdvggivlana
    cgpcigqwdrkdikkgekntivtsynrnftgrndanpethafvtspeivtalaiagtlkf
    npetdfltgkdgkkfkleapdadelpraefdpgqdtyqhppkdssgqrvdvsptsqrlql
    lepfdkwdgkdledlqilikvkgkcttdhisaagpwlkfrghldnisnnlligainsenr
    kansvrnavtqefgpvpdtaryykqhgirwvvigdenygegssrehsaleprflggraii
    tksfarihetnlkkqgllpltfadpadynkihpvdkltiqglkdfapgkpltciikhpng
    tqetillnhtfnetqiewfragsalnrmkelqqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1amjA (A:)
    rakvamshfepheyirydlleknidivrkrlnrpltlsekivyghlddpanqeiergkty
    lrlrpdrvamqdataqmamlqfissglpkvavpstihcdhlieaqlggekdlrrakdinq
    evynflatagakygvgfwrpgsgiihqiilenyaypgvlligtdshtpnggglggicigv
    ggadavdvmagipwelkcpkvigvkltgslsgwtspkdvilkvagiltvkggtgaiveyh
    gpgvdsisctgmaticnmgaeigattsvfpynhrmkkylsktgradianladefkdhlvp
    dsgchydqlieinlselkphingpftpdlahpvaevgsvaekegwpldirvgligsctns
    syedmgrsaavakqalahglkcksqftitpgseqiratierdgyaqvlrdvggivlanac
    gpcigqwdrkdikkgekntivtsynrnftgrndanpethafvtspeivtalaiagtlkfn
    petdfltgkdgkkfkleapdadelpraefdpgqdtyqhppkdssgqrvdvsptsqrlqll
    epfdkwdgkdledlqilikvkgkcttdhisaagpwlkfrghldnisnnlligainsenrk
    ansvrnavtqefgpvpdtaryykqhgirwvvigdenygegssrehsaleprflggraiit
    ksfarihetnlkkqgllpltfadpadynkihpvdkltiqglkdfapgkpltciikhpngt
    qetillnhtfnetqiewfragsalnrmkelqqk