PDB entry 1amh

View 1amh on RCSB PDB site
Description: uncomplexed rat trypsin mutant with asp 189 replaced with ser (d189s)
Class: hydrolase
Keywords: serine protease, activation domain, substrate specificity hydrolase
Deposited on 1997-06-17, released 1997-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.182
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anionic trypsin
    Species: Rattus rattus [TaxId:10117]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00763 (0-222)
      • engineered (170)
    Domains in SCOPe 2.07: d1amha_
  • Chain 'B':
    Compound: anionic trypsin
    Species: Rattus rattus [TaxId:10117]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00763 (0-222)
      • engineered (170)
    Domains in SCOPe 2.07: d1amhb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1amhA (A:)
    ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
    neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
    wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggksscqgdsggp
    vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1amhB (B:)
    ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
    neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
    wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggksscqgdsggp
    vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan