PDB entry 1amf

View 1amf on RCSB PDB site
Description: crystal structure of moda, a molybdate transport protein, complexed with molybdate
Class: binding protein
Keywords: molybdate transport protein, molybdate, periplasmic, binding protein
Deposited on 1997-06-13, released 1997-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.161
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: molybdate transport protein moda
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1amfa_
  • Heterogens: MOO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1amfA (A:)
    degkitvfaaasltnamqdiatqfkkekgvdvvssfassstlarqieagapadlfisadq
    kwmdyavdkkaidtatrqtllgnslvvvapkasvqkdftidsktnwtsllnggrlavgdp
    ehvpagiyakealqklgawdtlspklapaedvrgalalverneaplgivygsdavaskgv
    kvvatfpedshkkveypvavveghnnatvkafydylkgpqaaeifkrygftik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1amfA (A:)
    gkitvfaaasltnamqdiatqfkkekgvdvvssfassstlarqieagapadlfisadqkw
    mdyavdkkaidtatrqtllgnslvvvapkasvqkdftidsktnwtsllnggrlavgdpeh
    vpagiyakealqklgawdtlspklapaedvrgalalverneaplgivygsdavaskgvkv
    vatfpedshkkveypvavveghnnatvkafydylkgpqaaeifkrygftik