PDB entry 1ama

View 1ama on RCSB PDB site
Description: domain closure in mitochondrial aspartate aminotransferase
Class: transferase(aminotransferase)
Keywords: transferase(aminotransferase)
Deposited on 1992-02-05, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate aminotransferase
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00508 (0-400)
      • conflict (44)
    Domains in SCOPe 2.07: d1amaa_
  • Heterogens: PLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1amaA (A:)
    sswwshvemgppdpilgvteafkrdtnskkmnlgvgayrddngkpyvlncvrkaeamiaa
    kkmdkeylpiagladftrasaelalgenseafksgryvtvqgisgtgslrvganflqrff
    kfsrdvylpkpswgnhtpifrdaglqlqayryydpktcsldftgamediskipeksiill
    hacahnptgvdprqeqwkelasvvkkrnllayfdmayqgfasgdinrdawalrhfieqgi
    dvvlsqsyaknmglygeragaftvicrdaeeakrvesqlkilirpmysnppmngariasl
    ilntpelrkewlvevkgmadriismrtqlvsnlkkegsshnwqhitdqigmfcftglkpe
    qverltkefsiymtkdgrisvagvassnvgylahaihqvtk