PDB entry 1am9

View 1am9 on RCSB PDB site
Description: human srebp-1a bound to ldl receptor promoter
Deposited on 1997-06-25, released 1998-07-01
The last revision prior to the SCOP 1.67 freeze date was dated 1998-07-01, with a file datestamp of 1998-07-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.219
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1am9a_
  • Chain 'B':
    Domains in SCOP 1.67: d1am9b_
  • Chain 'C':
    Domains in SCOP 1.67: d1am9c_
  • Chain 'D':
    Domains in SCOP 1.67: d1am9d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1am9A (A:)
    qsrgekrtahnaiekryrssindkiielkdlvvgteaklnksavlrkaidyirflqhsnq
    klkqenlslrtavhkskslkdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1am9A (A:)
    qsrgekrtahnaiekryrssindkiielkdlvvgteaklnksavlrkaidyirflqhsnq
    klkqenlslrtavhkskslk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1am9B (B:)
    qsrgekrtahnaiekryrssindkiielkdlvvgteaklnksavlrkaidyirflqhsnq
    klkqenlslrtavhkskslkdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1am9B (B:)
    srgekrtahnaiekryrssindkiielkdlvvgteaklnksavlrkaidyirflqhsnqk
    lkqenlslrtavhks
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1am9C (C:)
    qsrgekrtahnaiekryrssindkiielkdlvvgteaklnksavlrkaidyirflqhsnq
    klkqenlslrtavhkskslkdl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1am9D (D:)
    qsrgekrtahnaiekryrssindkiielkdlvvgteaklnksavlrkaidyirflqhsnq
    klkqenlslrtavhkskslkdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1am9D (D:)
    qsrgekrtahnaiekryrssindkiielkdlvvgteaklnksavlrkaidyirflqhsnq
    klkqenlslrtavhks