PDB entry 1am7

View 1am7 on RCSB PDB site
Description: Lysozyme from bacteriophage lambda
Class: glycosidase
Keywords: glycosidase, transglycosylase, evolution, lysozyme
Deposited on 1997-06-24, released 1997-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.163
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Enterobacteria phage lambda [TaxId:10710]
    Gene: R
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03706 (0-End)
      • modified residue (16)
      • modified residue (72-73)
      • modified residue (123)
    Domains in SCOPe 2.07: d1am7a_
  • Chain 'B':
    Compound: lysozyme
    Species: Enterobacteria phage lambda [TaxId:10710]
    Gene: R
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03706 (0-End)
      • modified residue (16)
      • modified residue (72-73)
      • modified residue (123)
    Domains in SCOPe 2.07: d1am7b_
  • Chain 'C':
    Compound: lysozyme
    Species: Enterobacteria phage lambda [TaxId:10710]
    Gene: R
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03706 (0-End)
      • modified residue (16)
      • modified residue (72-73)
      • modified residue (123)
    Domains in SCOPe 2.07: d1am7c_
  • Heterogens: IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1am7A (A:)
    mveinnqrkafldmlawsegtdngrqktrnhgydvivggelftdysdhprklvtlnpklk
    stgagryqllsrwwdayrkqlglkdfspksqdavalqqikergalpmidrgdirqaidrc
    sniwaslpgagygqfehkadsliakfkeaggtvreidv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1am7A (A:)
    mveinnqrkafldmlawsegtdngrqktrnhgydvivggelftdysdhprklvtlnpklk
    stgagryqllsrwwdayrkqlglkdfspksqdavalqqikergalpmidrgdirqaidrc
    sniwaslpgagygqfehkadsliakfkeaggtvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1am7B (B:)
    mveinnqrkafldmlawsegtdngrqktrnhgydvivggelftdysdhprklvtlnpklk
    stgagryqllsrwwdayrkqlglkdfspksqdavalqqikergalpmidrgdirqaidrc
    sniwaslpgagygqfehkadsliakfkeaggtvreidv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1am7B (B:)
    mveinnqrkafldmlawsegtdngrqktrnhgydvivggelftdysdhprklvtlnpklk
    stgagryqllsrwwdayrkqlglkdfspksqdavalqqikergalpmidrgdirqaidrc
    sniwaslpgagygqfehkadsliakfkeaggtvr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1am7C (C:)
    mveinnqrkafldmlawsegtdngrqktrnhgydvivggelftdysdhprklvtlnpklk
    stgagryqllsrwwdayrkqlglkdfspksqdavalqqikergalpmidrgdirqaidrc
    sniwaslpgagygqfehkadsliakfkeaggtvreidv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1am7C (C:)
    mveinnqrkafldmlawsegtdngrqktrnhgydvivggelftdysdhprklvtlnpklk
    stgagryqllsrwwdayrkqlglkdfspksqdavalqqikergalpmidrgdirqaidrc
    sniwaslpgagygqfehkadsliakfkeaggtvr