PDB entry 1am4

View 1am4 on RCSB PDB site
Description: complex between cdc42hs.gmppnp and p50 rhogap (h. sapiens)
Deposited on 1997-06-22, released 1998-07-15
The last revision prior to the SCOP 1.55 freeze date was dated 1998-07-15, with a file datestamp of 1998-07-15.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.23
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1am4a_
  • Chain 'B':
    Domains in SCOP 1.55: d1am4b_
  • Chain 'C':
    Domains in SCOP 1.55: d1am4c_
  • Chain 'D':
    Domains in SCOP 1.55: d1am4d_
  • Chain 'E':
    Domains in SCOP 1.55: d1am4e_
  • Chain 'F':
    Domains in SCOP 1.55: d1am4f_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1am4A (A:)
    prpplpnqqfgvslqhlqeknpeqepipivlretvaylqahalttegifrrsantqvvre
    vqqkynmglpvdfdqynelhlpavilktflrelpeplltfdlyphvvgflnidesqrvpa
    tlqvlqtlpeenyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwakdaaitlka
    inpintftkflldhqgelf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1am4B (B:)
    prpplpnqqfgvslqhlqeknpeqepipivlretvaylqahalttegifrrsantqvvre
    vqqkynmglpvdfdqynelhlpavilktflrelpeplltfdlyphvvgflnidesqrvpa
    tlqvlqtlpeenyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwakdaaitlka
    inpintftkflldhqgelf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1am4C (C:)
    prpplpnqqfgvslqhlqeknpeqepipivlretvaylqahalttegifrrsantqvvre
    vqqkynmglpvdfdqynelhlpavilktflrelpeplltfdlyphvvgflnidesqrvpa
    tlqvlqtlpeenyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwakdaaitlka
    inpintftkflldhqgelf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1am4D (D:)
    pqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqrglknvfdeailaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1am4D (D:)
    pqtikcvvvgdgavgktcllisyttnkfyvptvfdnyavtvmiggepytlglfdtagqed
    ydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlrddp
    stieklaknkqkpitpetaeklardlkavkyvecsaltqrglknvfdeailaal
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1am4E (E:)
    pqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqrglknvfdeailaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1am4E (E:)
    pqtikcvvvgdgavgktcllisyttnkfyvptvfdnyavtvmiggepytlglfdtagqed
    ydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlrddp
    stieklaknkqkpitpetaeklardlkavkyvecsaltqrglknvfdeailaal
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1am4F (F:)
    pqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqrglknvfdeailaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1am4F (F:)
    pqtikcvvvgdgavgktcllisyttnkfyvptvfdnyavtvmiggepytlglfdtagqed
    ydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlrddp
    stieklaknkqkpitpetaeklardlkavkyvecsaltqrglknvfdeailaal