PDB entry 1am2

View 1am2 on RCSB PDB site
Description: gyra intein from mycobacterium xenopi
Class: intein
Keywords: intein, protein splicing
Deposited on 1997-06-20, released 1998-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.187
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mxe gyra intein
    Species: Mycobacterium xenopi [TaxId:1789]
    Gene: rtp
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72065 (2-198)
      • variant (60)
      • variant (150)
    Domains in SCOPe 2.07: d1am2a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1am2A (A:)
    asitgdalvalpegesvriadivpgarpnsdnaidlkvldrhgnpvladrlfhsgehpvy
    avrtveglrvtgtanhpllclvdvagvptllwklideikpgdyaviqrsafsvdcagfar
    gkpefapttytvgvpglvrfleahhrdpdakaiadeltdgrfyyakvasvtdagvqpvys
    lrvdtadhafitngfvshn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1am2A (A:)
    asitgdalvalpegesvriadivpgarpnsdnaidlkvldrhgnpvladrlfhsgehpvy
    avrtveglrvtgtanhpllclvdvagvptllwklideikpgdyaviqrsafstvgvpglv
    rfleahhrdpdakaiadeltdgrfyyakvasvtdagvqpvyslrvdtadhafitngfvsh
    n