PDB entry 1aly

View 1aly on RCSB PDB site
Description: crystal structure of human cd40 ligand
Class: cytokine
Keywords: cd40l, cd40 ligand, cytokine, tnf, hyper-igm syndrome
Deposited on 1997-06-05, released 1997-09-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.223
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cd40 ligand
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P29965 (0-145)
  Domains in SCOPe 2.03: d1alya_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1alyA (A:)
  gdqnpqiaahviseasskttsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqv
  tfcsnreassqapfiaslclkspgrferillraanthssakpcgqqsihlggvfelqpga
  svfvnvtdpsqvshgtgftsfgllkl