PDB entry 1alw

View 1alw on RCSB PDB site
Description: inhibitor and calcium bound domain vi of porcine calpain
Class: calcium binding
Keywords: calcium binding, calmodulin like, domain of cystein protease
Deposited on 1997-06-04, released 1998-06-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.21
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calpain
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1alwa_
  • Chain 'B':
    Compound: calpain
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1alwb_
  • Heterogens: CA, ISA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1alwA (A:)
    eevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
    tgklgfeefkylwnnikkwqaiykqfdvdrsgtigsselpgafeaagfhlnehlysmiir
    rysdeggnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlqltmys
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1alwB (B:)
    eevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
    tgklgfeefkylwnnikkwqaiykqfdvdrsgtigsselpgafeaagfhlnehlysmiir
    rysdeggnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlqltmys