PDB entry 1alu

View 1alu on RCSB PDB site
Description: human interleukin-6
Deposited on 1997-06-03, released 1998-06-03
The last revision prior to the SCOP 1.71 freeze date was dated 1998-06-03, with a file datestamp of 1998-06-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.213
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1alu__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1alu_ (-)
    mapvppgedskdvaaphrqpltsseridkqiryildgisalrketcnksnmcesskeala
    ennlnlpkmaekdgcfqsgfneetclvkiitgllefevyleylqnrfesseeqaravqms
    tkvliqflqkkaknldaittpdpttnaslltklqaqnqwlqdmtthlilrsfkeflqssl
    ralrqm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1alu_ (-)
    ltsseridkqiryildgisalrketcnksnmcenlnlpkmaekdgcfqsgfneetclvki
    itgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaittpdpttnasl
    ltklqaqnqwlqdmtthlilrsfkeflqsslralrqm