PDB entry 1alr

View 1alr on RCSB PDB site
Description: structures of human and porcine aldehyde reductase: an enzyme implicated in diabetic complications
Deposited on 1994-09-06, released 1995-09-15
The last revision was dated 1995-11-03, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence, based on SEQRES records:
    >1alr_ (-)
    aascvllhtgqkmpliglgtwksepgqvkaavkyalsvgyrhidcaaiygnepeigealk
    edvgpgkavpreelfvtsklwntkhhpedvepalrktladlqleyldlylmhwpyaferg
    dnpfpknadgticydsthyketwkalealvakglvqalglsnfnsrqiddilsvasvrpa
    vlqvechpylaqneliahcqarglevtaysplgssdrawrdpdepvlleepvvlalaeky
    grspaqillrwqvqrkvicipksitpsrilqnikvfdftfspeemkqlnalnknwryivp
    mltvdgkrvprdaghplypfndpy
    

    Sequence, based on observed residues (ATOM records):
    >1alr_ (-)
    aascvllhtgqkmpliglgtwksepgqvkaavkyalsvgyrhidcaaiygnepeigealk
    edvgpgkavpreelfvtsklwntkhhpedvepalrktladlqleyldlylmhwpyaferg
    dnpfpknadgticydsthyketwkalealvakglvqalglsnfnsrqiddilsvasvrpa
    vlqvechpylaqneliahcqarglevtaysplgssdvlleepvvlalaekygrspaqill
    rwqvqrkvicipksitpsrilqnikvfdftfspeemkqlnalnknwryivpmltvdgkrv
    prdaghplypf
    

  • Chain 'p':
    No sequence available.