PDB entry 1alq

View 1alq on RCSB PDB site
Description: circularly permuted beta-lactamase from staphylococcus aureus pc1
Class: hydrolase
Keywords: hydrolase, circular permuted, antibiotic resistance
Deposited on 1997-06-02, released 1997-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.196
AEROSPACI score: -3.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cp254 beta-lactamase
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1alqa_
  • Heterogens: SO4, CO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1alqA (A:)
    mgqsepivlviftnkdnksdkpndklisetaksvmkefaagsknaakelndlekkynahi
    gvyaldtksgkevkfnsdkrfayastskainsailleqvpynklnkkvhinkddivaysp
    ilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrlkelgdkvtnpvryei
    elnyyspkskkdtstpaafgktlnkliangklskenkkflldlmlnnksgdtlikdgvpk
    dykvadksgqaityasrndvafvypk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1alqA (A:)
    sepivlviftnkdnksdkpndklisetaksvmkefaaaakelndlekkynahigvyaldt
    ksgkevkfnsdkrfayastskainsailleqvpynklnkkvhinkddivayspilekyvg
    kditlkalieasmtysdntannkiikeiggikkvkqrlkelgdkvtnpvryeielnyysp
    kskkdtstpaafgktlnkliangklskenkkflldlmlnnksgdtlikdgvpkdykvadk
    sgqaityasrndvafvypk