PDB entry 1alo

View 1alo on RCSB PDB site
Description: aldehyde oxidoreductase
Deposited on 1995-09-20, released 1997-01-11
The last revision was dated 1997-01-11, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.179
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: CL, MG, FES, MO, MCN, IPA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1alo_ (-)
    miqkvitvngieqnlfvdaeallsdvlrqqlgltgvkvgceqgqcgacsvildgkvvrac
    vtkmkrvadgaqittiegvgqpenlhplqkawvlhggaqcgfcspgfivsakglldtnad
    psredvrdwfqkhrnacrctgykplvdavmdaaavingkkpetdlefkmpadgriwgsky
    prptavakvtgtldygadlglkmpagtlhlamvqakvshanikgidtsealtmpgvhsvi
    thkdvkgknritglitfptnkgdgwdrpilcdekvfqygdcialvcadseanaraaaekv
    kvdleelpaymsgpaaaaedaieihpgtpnvyfeqpivkgedtgpifasadvtvegdfyv
    grqphmpiepdvafaymgddgkcyihsksigvhlhlymiapgvglepdqlvlvanpmggt
    fgykfsptsealvavaamatgrpvhlrynyqqqqqytgkrspwemnvkfaakkdgtllam
    esdwlvdhgpysefgdlltlrgaqfigagynipnirglgrtvatnhvwgsafrgygapqs
    mfaseclmdmlaeklgmdplelryknayrpgdtnptgqepevfslpdmidqlrpkyqaal
    ekaqkestathkkgvgisigvygsgldgpdaseawaelnadgtitvhtawedhgqgadig
    cvgtahealrpmgvapekikftwpntattpnsgpsggsreqvmtgnairvacenllkace
    kpgggyytydelkaadkptkitgnwtasgathcdavtglgkpfvvymygvfmaevtvdva
    tgqttvdgmtlmadlgslcnqlatdgqiygglaqgiglalsedfedikkhatlvgagfpf
    ikqipdkldivyvnhprpdgpfgasgvgelpltsphaaiinaiksatgvriyrlpaypek
    vlealka
    

  • Chain 'p':
    No sequence available.