PDB entry 1all

View 1all on RCSB PDB site
Description:
Deposited on 1995-03-01, released 1996-07-11
The last revision prior to the SCOP 1.55 freeze date was dated 1996-07-11, with a file datestamp of 1996-07-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.196
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1alla_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1allb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1allA (A:)
    sivtksivnadaearylspgeldriksfvtsgerrvriaetmtgareriikqagdqlfgk
    rpdvvspggnaygadmtatclrdldyylrlitygivagdvtpieeigvvgvremykslgt
    pieaiaegvramksvatsllsgadaaeagsyfdyligams
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1allB (B:)
    mqdaitsvinssdvqgkyldasaiqklkayfatgelrvraattisanaanivkeavaksl
    lysdvtrpggnmyttrryaacirdldyylryatyamlagdpsildervlnglketynslg
    vpigatvqaiqamkevtaglvgggagkemgiyfdyicsgls