PDB entry 1all

View 1all on RCSB PDB site
Description: allophycocyanin
Class: light-harvesting protein
Keywords: light-harvesting protein, phycobiliprotein
Deposited on 1995-03-01, released 1996-07-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.196
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: allophycocyanin
    Species: Arthrospira platensis [TaxId:118562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72504 (0-159)
      • conflict (51)
      • conflict (54)
      • conflict (58)
      • conflict (73-74)
      • conflict (124)
      • conflict (142)
      • conflict (149)
    Domains in SCOPe 2.08: d1alla_
  • Chain 'B':
    Compound: allophycocyanin
    Species: Arthrospira platensis [TaxId:118562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72505 (0-160)
      • conflict (20)
      • conflict (64)
      • conflict (142-143)
    Domains in SCOPe 2.08: d1allb_
  • Heterogens: CYC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1allA (A:)
    sivtksivnadaearylspgeldriksfvtsgerrvriaetmtgareriikqagdqlfgk
    rpdvvspggnaygadmtatclrdldyylrlitygivagdvtpieeigvvgvremykslgt
    pieaiaegvramksvatsllsgadaaeagsyfdyligams
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1allB (B:)
    mqdaitsvinssdvqgkyldasaiqklkayfatgelrvraattisanaanivkeavaksl
    lysdvtrpggnmyttrryaacirdldyylryatyamlagdpsildervlnglketynslg
    vpigatvqaiqamkevtaglvgggagkemgiyfdyicsgls