PDB entry 1alk

View 1alk on RCSB PDB site
Description: reaction mechanism of alkaline phosphatase based on crystal structures. two metal ion catalysis
Class: alkaline phosphatase
Keywords: alkaline phosphatase
Deposited on 1993-03-03, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.177
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alkaline phosphatase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00634 (0-448)
      • conflict (14)
      • conflict (34)
      • conflict (175)
      • conflict (227)
      • conflict (229)
    Domains in SCOPe 2.07: d1alka_
  • Chain 'B':
    Compound: alkaline phosphatase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00634 (0-448)
      • conflict (14)
      • conflict (34)
      • conflict (175)
      • conflict (227)
      • conflict (229)
    Domains in SCOPe 2.07: d1alkb_
  • Heterogens: ZN, MG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1alkA (A:)
    tpempvlenraaqgnitapggarrltgdqtaalrnslsdkpakniilligdgmgdseita
    arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngal
    gvdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsqkcpg
    nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreeaeargyqlvsda
    aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
    qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
    ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
    aygphaanvvgltdqtdlfytmkaalglk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1alkB (B:)
    tpempvlenraaqgnitapggarrltgdqtaalrnslsdkpakniilligdgmgdseita
    arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngal
    gvdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsqkcpg
    nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreeaeargyqlvsda
    aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
    qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
    ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
    aygphaanvvgltdqtdlfytmkaalglk