PDB entry 1ali

View 1ali on RCSB PDB site
Description: alkaline phosphatase mutant (h412n)
Class: hydrolase (phosphoric monoester)
Keywords: hydrolase (phosphoric monoester), transferase (phospho, alcohol acceptor)
Deposited on 1995-06-02, released 1995-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.174
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alkaline phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: PHOA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00634 (Start-448)
      • engineered (411)
    Domains in SCOPe 2.07: d1alia_
  • Chain 'B':
    Compound: alkaline phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: PHOA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00634 (Start-448)
      • engineered (411)
    Domains in SCOPe 2.07: d1alib_
  • Heterogens: ZN, MG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aliA (A:)
    tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
    arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngal
    gvdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpg
    nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsda
    aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
    qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
    ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqentgsqlria
    aygphaanvvgltdqtdlfytmkaalglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aliA (A:)
    mpvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseitaarn
    yaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngalgvd
    ihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpgnal
    ekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaasl
    nsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmt
    dkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkegntl
    vivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqentgsqlriaayg
    phaanvvgltdqtdlfytmkaalglk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1aliB (B:)
    tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
    arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngal
    gvdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpg
    nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsda
    aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
    qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
    ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqentgsqlria
    aygphaanvvgltdqtdlfytmkaalglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aliB (B:)
    mpvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseitaarn
    yaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngalgvd
    ihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpgnal
    ekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaasl
    nsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmt
    dkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkegntl
    vivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqentgsqlriaayg
    phaanvvgltdqtdlfytmkaalglk