PDB entry 1alc

View 1alc on RCSB PDB site
Description: refined structure of baboon alpha-lactalbumin at 1.7 angstroms resolution. comparison with c-type lysozyme
Class: calcium binding protein
Keywords: calcium binding protein
Deposited on 1989-08-14, released 1989-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.22
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-lactalbumin
    Species: Papio cynocephalus [TaxId:9556]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12065 (0-End)
      • conflict (44)
    Domains in SCOPe 2.07: d1alca_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1alcA (A:)
    kqftkcelsqnlydidgygrialpelictmfhtsgydtqaivendesteyglfqisnalw
    ckssqspqsrnicditcdkflddditddimcakkildikgidywiahkalctekleqwlc
    eke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1alcA (A:)
    kqftkcelsqnlydidgygrialpelictmfhtsgydtqaivendesteyglfqisnalw
    ckssqspqsrnicditcdkflddditddimcakkildikgidywiahkalctekleqwlc
    ek