PDB entry 1alb

View 1alb on RCSB PDB site
Description: crystal structure of recombinant murine adipocyte lipid-binding protein
Class: lipid binding protein
Keywords: lipid-binding protein, lipid binding protein
Deposited on 1992-09-03, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: adipocyte lipid-binding protein
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04117 (0-130)
  Domains in SCOPe 2.08: d1alba_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1albA (A:)
  cdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdlvtirsestfknt
  eisfklgvefdeitaddrkvksiitldggalvqvqkwdgksttikrkrdgdklvvecvmk
  gvtstrvyera