PDB entry 1ala

View 1ala on RCSB PDB site
Description: structure of chicken annexin v at 2.25-angstroms resolution
Class: calcium/phospholipid-binding protein
Keywords: calcium/phospholipid-binding protein
Deposited on 1993-01-14, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.197
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: annexin v
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17153
      • conflict (167)
    Domains in SCOPe 2.07: d1alaa_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1alaA (A:)
    makytrgtvtafspfdaradaealrkamkgmgtdeetilkiltsrnnaqrqeiasafktl
    fgrdlvddlkseltgkfetlmvslmrparifdahalkhaikgagtnekvlteilasrtpa
    evqnikqvymqeyeanledkitgetsghfqrllvvllqanrdpdgrveealvekdaqvlf
    ragelkwgtdeetfitilgtrsvshlrrvfdkymtisgfqieetidretsgdleklllav
    vkcirsvpayfaetlyysmkgagtdddtlirvmvsrseidlldirhefrknfakslyqmi
    qkdtsgdyrkallllcggdde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1alaA (A:)
    kytrgtvtafspfdaradaealrkamkgmgtdeetilkiltsrnnaqrqeiasafktlfg
    rdlvddlkseltgkfetlmvslmrparifdahalkhaikgagtnekvlteilasrtpaev
    qnikqvymqeyeanledkitgetsghfqrllvvllqanrdpdgrveealvekdaqvlfra
    gelkwgtdeetfitilgtrsvshlrrvfdkymtisgfqieetidretsgdleklllavvk
    cirsvpayfaetlyysmkgagtdddtlirvmvsrseidlldirhefrknfakslyqmiqk
    dtsgdyrkallllcgg